Regulated Amino H2O
$10.00
Important research use notice For qualified laboratory research only. Not for human or animal use.
Read notice ↗
Study areas
Product artwork. Refer to the supplied label and batch documentation.
Sermorelin
$70.00
Test results & batch recordsView available COAs, results & lot history
Sermorelin is a GHRH-fragment research material listed in a vial format.
Bulk orders10–49 or 50+ units
Per product and strength, off the regular price. Automatic savings; discounts cannot be combined.
Complimentary 2-day delivery on bulk orders.
Order multiple products in bulk ↗Delivery & checkoutFree standard shipping on $100+
Complete your lab setupRegulated Amino H2O & insulated packaging
COMPLETE YOUR LAB SETUP
↗
CoolTemp Insulated Bag
$12.00
CONTINUE YOUR RESEARCH
Materials for your next study.
Explore related research materials and lab essentials. Choose a size and add it straight to your bag.
Shop all products ↗↗Lab essentials
CoolTemp Insulated Bag
GH signaling↗Peptide blends
CJC-1295 / Ipamorelin
GH signaling↗Nasal formats
Sermorelin Nasal
GH signalingMetabolic research↗Peptide blends
Tesamorelin / Ipamorelin (13/3 MG)
Tissue & matrix↗Research peptides
BPC-157
Dermal biologyTissue & matrix↗Research peptides
GHK-Cu
DOCUMENTATION, MADE ACCESSIBLE
Verified test results
Review the evidence for Sermorelin — 10 MG. Published results must be traceable to the original report and the lot on your packaging.
No verified batch results are published yet.
Sermorelin — 10 MG documentation will appear here after the actual report is uploaded and reviewed. No purity, identity, or pass/fail result is implied.
Request a batch COA →Identity
Not reportedAwaiting the original batch certificate.
Purity
Not reportedAwaiting the original batch certificate.
Net content
Not reportedAwaiting the original batch certificate.
Microbiological results
Not reportedAwaiting the original batch certificate.
A TRACEABLE RESEARCH RECORD
Every batch on record.
The archive for Sermorelin — 10 MG. Only published, reviewed records are listed; an absent lot has no published documentation here.
No batch records have been published for this product yet.
Ask about your batch ↗TECHNICAL SPECS
Compound & formulation information.
Catalog details and published reference information for Sermorelin. Reference compound properties are separate from the identity, composition, and results of an individual batch.
Catalog specification
- Product
- Sermorelin
- Format
- Vial-format material
- Listed package amount
- 10 MG
- Product code
- RA-4-10-MG
- Documentation
- Supplier / batch documentation pending
- Intended use
- Controlled laboratory research
Formulation & handling
Follow the supplied label and supplier documentation for handling and storage. A batch-specific storage temperature, shelf life, salt form, and complete formulation have not been verified here.
Ask for a specification sheet ↗GHRH peptide fragment
Sermorelin
Sermorelin is the amidated 29-residue amino-terminal fragment of human growth hormone-releasing hormone. It is studied in relation to pituitary growth hormone secretion and peptide structure–activity relationships. Human research has compared the endocrine responses associated with different GHRH chain lengths and with modified versions of the same peptide fragment.
Reference molecular profile
- Residue count
- 29
- Reference sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Reference information does not confirm the salt, variant, composition, or identity supplied in this catalog item.
PEER-REVIEWED LITERATURE
The research, with its sources.
Published compound and ingredient research is provided as scientific context for Sermorelin. These papers do not verify this supplier’s product, its finished formulation, or any batch. Study findings are specific to the model and conditions described.
- 01
Stimulation of growth hormone secretion with human growth hormone releasing factors (GRF1-44, GRF1-40, GRF1-29) in normal subjects
A small volunteer study compared measured growth hormone responses to three lengths of growth hormone-releasing factor, including GRF1-29.
- 02
Bioactivity of growth hormone releasing hormone (1-29) analogues after SC injection in man
Researchers compared GHRH(1-29)-amide and an amino-terminally modified analogue using peptide and growth hormone measurements in male volunteers.
IMPORTANT RESEARCH USAGE NOTICE
For research. With responsibility.
Sermorelin is offered exclusively for controlled laboratory research by qualified professionals. Not for human or animal use, consumption, or administration.
Products are not intended to diagnose, treat, cure, or prevent disease. Literature is provided for research reference and is not medical advice or evidence validating this product. Purchasers must meet the store’s research eligibility requirements and review the supplied documentation before use.
Read the research use policy ↗DOCUMENTATION, MADE ACCESSIBLE
Verified test results
Review the evidence for Sermorelin — select mass. Published results must be traceable to the original report and the lot on your packaging.
No verified batch results are published yet.
Sermorelin — select mass documentation will appear here after the actual report is uploaded and reviewed. No purity, identity, or pass/fail result is implied.
Request a batch COA →Identity
Not reportedAwaiting the original batch certificate.
Purity
Not reportedAwaiting the original batch certificate.
Net content
Not reportedAwaiting the original batch certificate.
Microbiological results
Not reportedAwaiting the original batch certificate.
A TRACEABLE RESEARCH RECORD
Every batch on record.
The archive for Sermorelin — select mass. Only published, reviewed records are listed; an absent lot has no published documentation here.
No batch records have been published for this product yet.
Ask about your batch ↗